Lineage for d2wu8a_ (2wu8 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140243Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 2140244Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 2140444Family c.80.1.0: automated matches [191405] (1 protein)
    not a true family
  6. 2140445Protein automated matches [190547] (14 species)
    not a true protein
  7. 2140503Species Mycobacterium tuberculosis [TaxId:83332] [189097] (1 PDB entry)
  8. 2140504Domain d2wu8a_: 2wu8 A: [169637]
    automated match to d1dqra_
    complexed with so4

Details for d2wu8a_

PDB Entry: 2wu8 (more details), 2.25 Å

PDB Description: structural studies of phosphoglucose isomerase from mycobacterium tuberculosis h37rv
PDB Compounds: (A:) Glucose-6-phosphate isomerase

SCOPe Domain Sequences for d2wu8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu8a_ c.80.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
pditatpawdalarhhdqignthlrqffaddpgrgreltvsvgdlyidyskhrvtretla
llidlartahleerrdqmfagvhintsedravlhtalrlprdaelvvdgqdvvtdvhavl
damgaftdrlrsgewtgatgkristvvnigiggsdlgpvmvyqalrhyadagisarfvsn
vdpadliatladldpattlfivasktfstletltnataarrwltdalgdaavsrhfvavs
tnkrlvddfgintdnmfgfwdwvggrysvdsaiglslmtvigrdafadflagfhiidrhf
ataplesnapvllgliglwysnffgaqsrtvlpysndlsrfpaylqqltmesngkstrad
gspvsadtgeifwgepgtngqhafyqllhqgtrlvpadfigfaqplddlptaegtgsmhd
llmsnffaqtqvlafgktaeeiaadgtpahvvahkvmpgnrpstsilasrltpsvlgqli
alyehqvftegvvwgidsfdqwgvelgktqakallpvitgagspppqsdsstdglvrryr
tergragle

SCOPe Domain Coordinates for d2wu8a_:

Click to download the PDB-style file with coordinates for d2wu8a_.
(The format of our PDB-style files is described here.)

Timeline for d2wu8a_: