| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) ![]() |
| Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins) |
| Protein Signal sequence recognition protein Ffh [47366] (3 species) |
| Species Thermus aquaticus [TaxId:271] [47367] (16 PDB entries) |
| Domain d3ng1a1: 3ng1 A:1-88 [16963] Other proteins in same PDB: d3ng1a2, d3ng1b2 complexed with cd, edo, so4 |
PDB Entry: 3ng1 (more details), 2.3 Å
SCOPe Domain Sequences for d3ng1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ng1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg
Timeline for d3ng1a1: