Lineage for d2wu2g_ (2wu2 G:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059237Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 1059295Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) (S)
    two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains
  5. 1059313Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (5 proteins)
    consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups
  6. 1059338Protein Succinate dehydrogenase subunit SdhC [82870] (1 species)
    Cytochrome b556 subunit
  7. 1059339Species Escherichia coli [TaxId:562] [82871] (7 PDB entries)
  8. 1059344Domain d2wu2g_: 2wu2 G: [169628]
    automated match to d1nekc_
    complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant

Details for d2wu2g_

PDB Entry: 2wu2 (more details), 2.5 Å

PDB Description: crystal structure of the e. coli succinate:quinone oxidoreductase (sqr) sdhc his84met mutant
PDB Compounds: (G:) succinate dehydrogenase cytochrome b556 subunit

SCOPe Domain Sequences for d2wu2g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu2g_ f.21.2.2 (G:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]}
qrpvnldlqtirfpitaiasilhrvsgvitfvavgillwllgtslsspegfeqasaimgs
ffvkfimwgiltalaymvvvgirhmmmdfgyleetfeagkrsakisfvitvvlsllagvl
vw

SCOPe Domain Coordinates for d2wu2g_:

Click to download the PDB-style file with coordinates for d2wu2g_.
(The format of our PDB-style files is described here.)

Timeline for d2wu2g_: