| Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
| Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families) ![]() two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains |
| Family f.21.2.2: Succinate dehydrogenase/Fumarate reductase transmembrane subunits (SdhC/FrdC and SdhD/FrdD) [81373] (7 proteins) consists of two homologous non-identical subunits that form a heterodimer; may or may not contain heme groups |
| Protein Succinate dehydrogenase subunit SdhC [82870] (1 species) Cytochrome b556 subunit |
| Species Escherichia coli [TaxId:562] [82871] (7 PDB entries) |
| Domain d2wu2c_: 2wu2 C: [169627] Other proteins in same PDB: d2wu2a1, d2wu2a2, d2wu2a3, d2wu2b1, d2wu2b2, d2wu2d_, d2wu2e1, d2wu2e2, d2wu2e3, d2wu2f1, d2wu2f2, d2wu2h_, d2wu2i1, d2wu2i2, d2wu2i3, d2wu2j1, d2wu2j2, d2wu2l_ automated match to d1nekc_ complexed with cbe, f3s, fad, fes, hem, na, sf4, teo; mutant |
PDB Entry: 2wu2 (more details), 2.5 Å
SCOPe Domain Sequences for d2wu2c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu2c_ f.21.2.2 (C:) Succinate dehydrogenase subunit SdhC {Escherichia coli [TaxId: 562]}
qrpvnldlqtirfpitaiasilhrvsgvitfvavgillwllgtslsspegfeqasaimgs
ffvkfimwgiltalaymvvvgirhmmmdfgyleetfeagkrsakisfvitvvlsllagvl
vw
Timeline for d2wu2c_: