SCOPe 2.05: Domain d2wu1b_: 2wu1 B:

Lineage for d2wu1b_ (2wu1 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.1: NagB-like [52513] (3 proteins)
   share a common phosphate-binding site with the RpiA family

6. Protein automated matches [191092] (2 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189071] (1 PDB entry)

8. Domain d2wu1b_: 2wu1 B: [169626]
   automated match to d1cd5a_
   complexed with 16g, fgs

Details for d2wu1b_

PDB Entry: 2wu1, 2.2 Å

PDB Description: glucosamine-6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucoamine-6-phosphate both in the active and allosteric sites.

PDB Compounds: (B:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d2wu1b_:

Sequence; same for both SEQRES and ATOM records:

>d2wu1b_ c.124.1.1 (B:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

Timeline for d2wu1b_:

• d2wu1b_ first appeared in SCOPe 2.01
  
• d2wu1b_ appears in SCOPe 2.04
  
• d2wu1b_ appears in SCOPe 2.06
  
• d2wu1b_ appears in the current release, SCOPe 2.08