![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily) core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) ![]() |
![]() | Family c.124.1.1: NagB-like [52513] (3 proteins) share a common phosphate-binding site with the RpiA family |
![]() | Protein automated matches [191092] (2 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189071] (1 PDB entry) |
![]() | Domain d2wu1a_: 2wu1 A: [169625] automated match to d1cd5a_ complexed with 16g, fgs |
PDB Entry: 2wu1 (more details), 2.2 Å
SCOPe Domain Sequences for d2wu1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wu1a_ c.124.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd epstmelkvktlryfneleaenikgl
Timeline for d2wu1a_: