Lineage for d2wu1a_ (2wu1 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922307Family c.124.1.1: NagB-like [52513] (3 proteins)
    share a common phosphate-binding site with the RpiA family
  6. 2922342Protein automated matches [191092] (2 species)
    not a true protein
  7. 2922343Species Escherichia coli K-12 [TaxId:83333] [189071] (1 PDB entry)
  8. 2922344Domain d2wu1a_: 2wu1 A: [169625]
    automated match to d1cd5a_
    complexed with 16g, fgs

Details for d2wu1a_

PDB Entry: 2wu1 (more details), 2.2 Å

PDB Description: glucosamine-6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucoamine-6-phosphate both in the active and allosteric sites.
PDB Compounds: (A:) glucosamine-6-phosphate deaminase

SCOPe Domain Sequences for d2wu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wu1a_ c.124.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOPe Domain Coordinates for d2wu1a_:

Click to download the PDB-style file with coordinates for d2wu1a_.
(The format of our PDB-style files is described here.)

Timeline for d2wu1a_: