SCOPe 2.01: Domain d2wtva_: 2wtv A:

Lineage for d2wtva_ (2wtv A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (254 PDB entries)

8. Domain d2wtva_: 2wtv A: [169620]
   automated match to d1ol5a_
   complexed with act, dms, edo, zzl

Details for d2wtva_

PDB Entry: 2wtv, 2.4 Å

PDB Description: aurora-a inhibitor structure

PDB Compounds: (A:) serine/threonine-protein kinase 6 aurora/ipl1-related kinase 1, breast tumor-amplified kinase, aurora-a, aurora-related kinase 1, hark1

SCOPe Domain Sequences for d2wtva_:

Sequence; same for both SEQRES and ATOM records:

>d2wtva_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrrevei
qshlrhpnilrlygyfhdatrvylileyaprgevykelqklskfdeqrtatyitelanal
sychskrvihrdikpenlllgsagelkiadfgwsvhapssrrttlcgtldylppemiegr
mhdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrll
khnpsqrpmlrevlehpwitanssk

Timeline for d2wtva_:

• d2wtva_ is new in SCOPe 2.01-stable
  
• d2wtva_ appears in SCOPe 2.02
  
• d2wtva_ appears in the current release, SCOPe 2.08