SCOP 1.71: Domain d2ng1_1: 2ng1 2-88

Lineage for d2ng1_1 (2ng1 2-88)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (24 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (11 PDB entries)

8. Domain d2ng1_1: 2ng1 2-88 [16962]
   Other proteins in same PDB: d2ng1_2
   complexed with dox, edo, gdp; mutant

Details for d2ng1_1

PDB Entry: 2ng1, 2.02 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d2ng1_1:

Sequence; same for both SEQRES and ATOM records:

>d2ng1_1 a.24.13.1 (2-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
fqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreealg
kqvlesltpaevilatvyealkealgg

Timeline for d2ng1_1:

• d2ng1_1 first appeared (with stable ids) in SCOP 1.55
  
• d2ng1_1 appears in SCOP 1.69
  
• d2ng1_1 is called d2ng1a1 in SCOP 1.73
  
• d2ng1_1 appears in the current release, SCOPe 2.08, called d2ng1a1