Lineage for d2ng1_1 (2ng1 2-88)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2887Fold a.29: Bromodomain-like [47363] (2 superfamilies)
  4. 2888Superfamily a.29.1: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 2889Family a.29.1.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)
  6. 2893Protein Signal sequence recognition protein Ffh [47366] (1 species)
  7. 2894Species Thermus aquaticus [TaxId:271] [47367] (5 PDB entries)
  8. 2897Domain d2ng1_1: 2ng1 2-88 [16962]
    Other proteins in same PDB: d2ng1_2

Details for d2ng1_1

PDB Entry: 2ng1 (more details), 2.02 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d2ng1_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ng1_1 a.29.1.1 (2-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
fqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreealg
kqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d2ng1_1:

Click to download the PDB-style file with coordinates for d2ng1_1.
(The format of our PDB-style files is described here.)

Timeline for d2ng1_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ng1_2