Lineage for d2ng1_1 (2ng1 2-88)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.29: Bromodomain-like [47363] (2 superfamilies) 
Superfamily a.29.1: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) 
Family a.29.1.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins) Protein Signal sequence recognition protein Ffh [47366] (1 species) Species Thermus aquaticus [TaxId:271] [47367] (5 PDB entries) 
Domain d2ng1_1: 2ng1 2-88 [16962]
Other proteins in same PDB: d2ng1_2
Details for d2ng1_1
PDB Entry: 2ng1 (more details), 2.02 Å
PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
SCOP Domain Sequences for d2ng1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ng1_1 a.29.1.1 (2-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
fqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreealg
kqvlesltpaevilatvyealkealgg
SCOP Domain Coordinates for d2ng1_1:
Click to download the PDB-style file with coordinates for d2ng1_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ng1_1:
- d2ng1_1 appears in SCOP 1.57
- d2ng1_1 appears in the current release, SCOPe 2.08, called d2ng1a1
View in 3D
