Class a: All alpha proteins [46456] (289 folds) |
Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (27 families) |
Family a.118.1.15: Mo25 protein [101407] (2 proteins) automatically mapped to Pfam PF08569 this is a repeat family; one repeat unit is 1upl A:195-240 found in domain |
Protein automated matches [191051] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188904] (4 PDB entries) |
Domain d2wtkd_: 2wtk D: [169619] Other proteins in same PDB: d2wtkc1, d2wtkf1 automated match to d1upka_ complexed with anp, so4 |
PDB Entry: 2wtk (more details), 2.65 Å
SCOPe Domain Sequences for d2wtkd_:
Sequence, based on SEQRES records: (download)
>d2wtkd_ a.118.1.15 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnekepqteavaq laqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfm llkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfk dlltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtky iskpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskf qndrtedeqfndektylvkqirdlkrp
>d2wtkd_ a.118.1.15 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kspadivknlkesmavlekqdisdkkaekateevsknlvamkeilygtnkepqteavaql aqelynsgllstlvadlqlidfegkkdvaqifnnilrrqigtrtptveyictqqnilfml lkgyespeialncgimlrecirheplakiilwseqfydffryvemstfdiasdafatfkd lltrhkllsaefleqhydrffseyekllhsenyvtkrqslkllgellldrhnftimtkyi skpenlklmmnllrdksrniqfeafhvfkvfvanpnktqpildillknqaklieflskfq ndredeqfndektylvkqirdlkrp
Timeline for d2wtkd_: