Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (21 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [189323] (2 PDB entries) |
Domain d2wthb_: 2wth B: [169617] automated match to d1asha_ complexed with gol, hem, oxy, so4 |
PDB Entry: 2wth (more details), 2.8 Å
SCOPe Domain Sequences for d2wthb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wthb_ a.1.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} smnrqeisdlcvkslegrmvgteaqniengnafyryfftnfpdlrvyfkgaekytaddvk kserfdkqgqrillachllanvytneevfkgyvretinrhriykmdpalwmafftvftgy lesvgslndqqkaawmalgkefnaesqthlknsnlphv
Timeline for d2wthb_: