SCOPe 2.08: Domain d2wtha_: 2wth A:

Lineage for d2wtha_ (2wth A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (26 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [189323] (2 PDB entries)

8. Domain d2wtha_: 2wth A: [169616]
   automated match to d1asha_
   complexed with gol, hem, oxy, so4

Details for d2wtha_

PDB Entry: 2wth, 2.8 Å

PDB Description: low resolution 3d structure of c.elegans globin-like protein (glb-1): p3121 crystal form

PDB Compounds: (A:) globin-like protein

SCOPe Domain Sequences for d2wtha_:

Sequence; same for both SEQRES and ATOM records:

>d2wtha_ a.1.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
smnrqeisdlcvkslegrmvgteaqniengnafyryfftnfpdlrvyfkgaekytaddvk
kserfdkqgqrillachllanvytneevfkgyvretinrhriykmdpalwmafftvftgy
lesvgslndqqkaawmalgkefnaesqthlknsnlphv

Timeline for d2wtha_:

• d2wtha_ first appeared in SCOPe 2.01
  
• d2wtha_ appears in SCOPe 2.07