Lineage for d2wtga_ (2wtg A:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1074917Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1074918Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1077287Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1077288Protein automated matches [190590] (12 species)
    not a true protein
  7. 1077315Species Nematode (Caenorhabditis elegans) [TaxId:6239] [189323] (2 PDB entries)
  8. 1077316Domain d2wtga_: 2wtg A: [169615]
    automated match to d1asha_
    complexed with hem, oxy

Details for d2wtga_

PDB Entry: 2wtg (more details), 1.5 Å

PDB Description: high resolution 3d structure of c.elegans globin-like protein glb-1
PDB Compounds: (A:) globin-like protein

SCOPe Domain Sequences for d2wtga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wtga_ a.1.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
smnrqeisdlcvkslegrmvgteaqniengnafyryfftnfpdlrvyfkgaekytaddvk
kserfdkqgqrillachllanvytneevfkgyvretinrhriykmdpalwmafftvftgy
lesvgslndqqkaawmalgkefnaesqthlknsnlphv

SCOPe Domain Coordinates for d2wtga_:

Click to download the PDB-style file with coordinates for d2wtga_.
(The format of our PDB-style files is described here.)

Timeline for d2wtga_: