Lineage for d2wt4a_ (2wt4 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142766Family c.88.1.0: automated matches [191606] (1 protein)
    not a true family
  6. 2142767Protein automated matches [191105] (4 species)
    not a true protein
  7. 2142768Species Helicobacter pylori [TaxId:210] [189137] (2 PDB entries)
  8. 2142770Domain d2wt4a_: 2wt4 A: [169614]
    automated match to d1wsaa_
    complexed with asp

Details for d2wt4a_

PDB Entry: 2wt4 (more details), 1.8 Å

PDB Description: Room temperature crystal structure of Helicobacter pylori L- asparaginase at 1.8 A resolution
PDB Compounds: (A:) L-asparaginase

SCOPe Domain Sequences for d2wt4a_:

Sequence, based on SEQRES records: (download)

>d2wt4a_ c.88.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
lptiallatggtiagsgvdaslgsyksgelgvkellkaipslnkiariqgeqvsnigsqd
mneeiwfklaqraqellddsriqgvvithgtdtleesayflnlvlhstkpvvlvgamrna
sslsadgalnlyeavsvavneksankgvlvvmddtifsvrevvkthtthvstfkalnsga
igsvyygktryymqplrkhttesefslsqlktplpkvdiiythagmtpdlfqaslnshak
gvviagvgngnvsagflkamqeasqmgvvivrssrvgsggvtsgeiddkaygfitsdnln
pqkarvllqlaltktndkakiqemfeey

Sequence, based on observed residues (ATOM records): (download)

>d2wt4a_ c.88.1.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
lptiallatggtiagsggvkellkaipslnkiariqgeqvsnigsqdmneeiwfklaqra
qellddsriqgvvithgtdtleesayflnlvlhstkpvvlvgamrnasslsadgalnlye
avsvavneksankgvlvvmddtifsvrevvkthtthvstfkalnsgaigsvyygktryym
qplrkhttesefslsqlktplpkvdiiythagmtpdlfqaslnshakgvviagvgngnvs
agflkamqeasqmgvvivrssrvgsggvtsgeiddkaygfitsdnlnpqkarvllqlalt
ktndkakiqemfeey

SCOPe Domain Coordinates for d2wt4a_:

Click to download the PDB-style file with coordinates for d2wt4a_.
(The format of our PDB-style files is described here.)

Timeline for d2wt4a_: