SCOPe 2.05: Domain d1ng1a1: 1ng1 A:1-88

Lineage for d1ng1a1 (1ng1 A:1-88)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (3 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (17 PDB entries)

8. Domain d1ng1a1: 1ng1 A:1-88 [16961]
   Other proteins in same PDB: d1ng1a2
   complexed with acy, cd, edo, gdp, mg

Details for d1ng1a1

PDB Entry: 1ng1, 2.03 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

PDB Compounds: (A:) signal sequence recognition protein ffh

SCOPe Domain Sequences for d1ng1a1:

Sequence; same for both SEQRES and ATOM records:

>d1ng1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d1ng1a1:

• d1ng1a1 first appeared (with stable ids) in SCOP 1.55, called d1ng1_1
  
• d1ng1a1 appears in SCOPe 2.04
  
• d1ng1a1 appears in SCOPe 2.06
  
• d1ng1a1 appears in the current release, SCOPe 2.08