Class a: All alpha proteins [46456] (171 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (16 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins) |
Protein Signal sequence recognition protein Ffh [47366] (2 species) |
Species Thermus aquaticus [TaxId:271] [47367] (8 PDB entries) |
Domain d1ng1_1: 1ng1 1-88 [16961] Other proteins in same PDB: d1ng1_2 complexed with acy, cd, edo, gdp, mo4, mo6 |
PDB Entry: 1ng1 (more details), 2.03 Å
SCOP Domain Sequences for d1ng1_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng1_1 a.24.13.1 (1-88) Signal sequence recognition protein Ffh {Thermus aquaticus} mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal gkqvlesltpaevilatvyealkealgg
Timeline for d1ng1_1: