SCOP 1.59: Domain d1ng1_1: 1ng1 1-88

Lineage for d1ng1_1 (1ng1 1-88)

1. Root: SCOP 1.59

2. Class a: All alpha proteins [46456] (151 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)

4. Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family)

5. Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)

6. Protein Signal sequence recognition protein Ffh [47366] (2 species)

7. Species Thermus aquaticus [TaxId:271] [47367] (7 PDB entries)

8. Domain d1ng1_1: 1ng1 1-88 [16961]
   Other proteins in same PDB: d1ng1_2

Details for d1ng1_1

PDB Entry: 1ng1, 2.03 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d1ng1_1:

Sequence; same for both SEQRES and ATOM records:

>d1ng1_1 a.24.13.1 (1-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

Timeline for d1ng1_1:

• d1ng1_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ng1_1 appears in SCOP 1.57
  
• d1ng1_1 appears in SCOP 1.61
  
• d1ng1_1 appears in the current release, SCOPe 2.08, called d1ng1a1