Lineage for d1ng1a1 (1ng1 A:1-88)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1987359Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1987995Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (2 families) (S)
  5. 1987996Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (3 protein domains)
  6. 1988011Protein Signal sequence recognition protein Ffh [47366] (3 species)
  7. 1988022Species Thermus aquaticus [TaxId:271] [47367] (17 PDB entries)
  8. 1988037Domain d1ng1a1: 1ng1 A:1-88 [16961]
    Other proteins in same PDB: d1ng1a2
    complexed with acy, cd, edo, gdp, mg

Details for d1ng1a1

PDB Entry: 1ng1 (more details), 2.03 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
PDB Compounds: (A:) signal sequence recognition protein ffh

SCOPe Domain Sequences for d1ng1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng1a1 a.24.13.1 (A:1-88) Signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
mfqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevardfvervreeal
gkqvlesltpaevilatvyealkealgg

SCOPe Domain Coordinates for d1ng1a1:

Click to download the PDB-style file with coordinates for d1ng1a1.
(The format of our PDB-style files is described here.)

Timeline for d1ng1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng1a2