SCOPe 2.05: Domain d2wsna_: 2wsn A:

Lineage for d2wsna_ (2wsn A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (16 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (40 PDB entries)

8. Domain d2wsna_: 2wsn A: [169607]
   automated match to d1qyoa_

Details for d2wsna_

PDB Entry: 2wsn, 1.37 Å

PDB Description: structure of enhanced cyan fluorescent protein at physiological ph

PDB Compounds: (A:) Green fluorescent protein

SCOPe Domain Sequences for d2wsna_:

Sequence; same for both SEQRES and ATOM records:

>d2wsna_ d.22.1.1 (A:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvtt
ltwgvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnri
elkgidfkedgnilghkleynyishnvyitadkqkngikanfkirhniedgsvqladhyq
qntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

Timeline for d2wsna_:

• d2wsna_ first appeared in SCOPe 2.01
  
• d2wsna_ appears in SCOPe 2.04
  
• d2wsna_ appears in SCOPe 2.06
  
• d2wsna_ appears in the current release, SCOPe 2.08