SCOPe 2.07: Domain d2wsja_: 2wsj A:

Lineage for d2wsja_ (2wsj A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins)
   Pfam PF05870; dimeric enzyme made of lipocalin-like subunits

6. Protein P-coumaric acid decarboxylase, pdc [141470] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [141471] (2 PDB entries)
   Uniprot Q88RY7 1-178

8. Domain d2wsja_: 2wsj A: [169604]
   automated match to d2gc9a1
   complexed with ba, cl, ipa, na; mutant

Details for d2wsja_

PDB Entry: 2wsj, 2.24 Å

PDB Description: crystal structure of single point mutant glu71ser p-coumaric acid decarboxylase

PDB Compounds: (A:) p-coumaric acid decarboxylase

SCOPe Domain Sequences for d2wsja_:

Sequence; same for both SEQRES and ATOM records:

>d2wsja_ b.60.1.6 (A:) P-coumaric acid decarboxylase, pdc {Lactobacillus plantarum [TaxId: 1590]}
tktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivmlt
egiykiswtsptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsre
kyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrl

Timeline for d2wsja_:

• d2wsja_ first appeared in SCOPe 2.01
  
• d2wsja_ appears in SCOPe 2.06
  
• d2wsja_ appears in the current release, SCOPe 2.08