![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
![]() | Superfamily b.60.1: Lipocalins [50814] (10 families) ![]() bind hydrophobic ligands in their interior |
![]() | Family b.60.1.6: Phenolic acid decarboxylase (PAD) [141469] (2 proteins) Pfam PF05870; dimeric enzyme made of lipocalin-like subunits |
![]() | Protein P-coumaric acid decarboxylase, pdc [141470] (1 species) |
![]() | Species Lactobacillus plantarum [TaxId:1590] [141471] (2 PDB entries) Uniprot Q88RY7 1-178 |
![]() | Domain d2wsja_: 2wsj A: [169604] automated match to d2gc9a1 complexed with ba, cl, ipa, na; mutant |
PDB Entry: 2wsj (more details), 2.24 Å
SCOPe Domain Sequences for d2wsja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wsja_ b.60.1.6 (A:) P-coumaric acid decarboxylase, pdc {Lactobacillus plantarum [TaxId: 1590]} tktfktlddflgthfiytydngweyewyakndhtvdyrihggmvagrwvtdqkadivmlt egiykiswtsptgtdvaldfmpnekklhgtiffpkwveehpeitvtyqnehidlmeqsre kyatypklvvpefanitymgdagqnnedviseapykempndirngkyfdqnyhrl
Timeline for d2wsja_: