![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
![]() | Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) ![]() |
![]() | Family b.115.1.0: automated matches [191398] (1 protein) not a true family |
![]() | Protein automated matches [190521] (2 species) not a true protein |
![]() | Species Burkholderia cenocepacia [TaxId:216591] [188413] (3 PDB entries) |
![]() | Domain d2wraa_: 2wra A: [169601] automated match to d1uqxa_ complexed with ca, so4 |
PDB Entry: 2wra (more details), 1.1 Å
SCOPe Domain Sequences for d2wraa_:
Sequence, based on SEQRES records: (download)
>d2wraa_ b.115.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} tssnragefsippntdfraiffanaaeqqhiklfigdsqepaayhklttrdgpreatlns gngkirfevsvngkpsatdarlapingkksdgspftvnfgivvsedghdsdyndgivvlq wpig
>d2wraa_ b.115.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} tssnragefsippntdfraiffanaaeqqhiklfigdsqepaayhklttrdgpreatlns gngkirfevsvngkpsatdarlapingkkgspftvnfgivvsedghdsdyndgivvlqwp ig
Timeline for d2wraa_: