Lineage for d2wraa_ (2wra A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 965953Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 965954Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 966047Family b.115.1.0: automated matches [191398] (1 protein)
    not a true family
  6. 966048Protein automated matches [190521] (2 species)
    not a true protein
  7. 966049Species Burkholderia cenocepacia [TaxId:216591] [188413] (3 PDB entries)
  8. 966050Domain d2wraa_: 2wra A: [169601]
    automated match to d1uqxa_
    complexed with ca, so4

Details for d2wraa_

PDB Entry: 2wra (more details), 1.1 Å

PDB Description: bcla lectin from burkholderia cenocepacia complexed with aman1(aman1- 6)-3man trisaccharide
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d2wraa_:

Sequence, based on SEQRES records: (download)

>d2wraa_ b.115.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tssnragefsippntdfraiffanaaeqqhiklfigdsqepaayhklttrdgpreatlns
gngkirfevsvngkpsatdarlapingkksdgspftvnfgivvsedghdsdyndgivvlq
wpig

Sequence, based on observed residues (ATOM records): (download)

>d2wraa_ b.115.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}
tssnragefsippntdfraiffanaaeqqhiklfigdsqepaayhklttrdgpreatlns
gngkirfevsvngkpsatdarlapingkkgspftvnfgivvsedghdsdyndgivvlqwp
ig

SCOPe Domain Coordinates for d2wraa_:

Click to download the PDB-style file with coordinates for d2wraa_.
(The format of our PDB-style files is described here.)

Timeline for d2wraa_: