Class a: All alpha proteins [46456] (151 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies) |
Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) |
Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins) |
Protein Signal sequence recognition protein Ffh [47366] (2 species) |
Species Thermus aquaticus [TaxId:271] [47367] (7 PDB entries) |
Domain d1ffh_1: 1ffh 2-88 [16960] Other proteins in same PDB: d1ffh_2 |
PDB Entry: 1ffh (more details), 2.05 Å
SCOP Domain Sequences for d1ffh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffh_1 a.24.13.1 (2-88) Signal sequence recognition protein Ffh {Thermus aquaticus} fqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreealg kqvlesltpaevilatvyealkealgg
Timeline for d1ffh_1: