Lineage for d1ffh_1 (1ffh 2-88)

  1. Root: SCOP 1.61
  2. 148221Class a: All alpha proteins [46456] (151 folds)
  3. 151228Fold a.24: Four-helical up-and-down bundle [47161] (14 superfamilies)
  4. 151458Superfamily a.24.13: Domain of the SRP/SRP receptor G-proteins [47364] (1 family) (S)
  5. 151459Family a.24.13.1: Domain of the SRP/SRP receptor G-proteins [47365] (2 proteins)
  6. 151463Protein Signal sequence recognition protein Ffh [47366] (2 species)
  7. 151467Species Thermus aquaticus [TaxId:271] [47367] (7 PDB entries)
  8. 151470Domain d1ffh_1: 1ffh 2-88 [16960]
    Other proteins in same PDB: d1ffh_2

Details for d1ffh_1

PDB Entry: 1ffh (more details), 2.05 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d1ffh_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffh_1 a.24.13.1 (2-88) Signal sequence recognition protein Ffh {Thermus aquaticus}
fqqlsarlqeaigrlrgrgriteedlkatlreirralmdadvnlevtrdfvervreealg
kqvlesltpaevilatvyealkealgg

SCOP Domain Coordinates for d1ffh_1:

Click to download the PDB-style file with coordinates for d1ffh_1.
(The format of our PDB-style files is described here.)

Timeline for d1ffh_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ffh_2