Class b: All beta proteins [48724] (180 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) |
Family b.115.1.0: automated matches [191398] (1 protein) not a true family |
Protein automated matches [190521] (2 species) not a true protein |
Species Burkholderia cenocepacia [TaxId:216591] [188413] (5 PDB entries) |
Domain d2wr9c_: 2wr9 C: [169599] automated match to d1uqxa_ complexed with ca, man, so4 |
PDB Entry: 2wr9 (more details), 1.75 Å
SCOPe Domain Sequences for d2wr9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wr9c_ b.115.1.0 (C:) automated matches {Burkholderia cenocepacia [TaxId: 216591]} nragefsippntdfraiffanaaeqqhiklfigdsqepaayhklttrdgpreatlnsgng kirfevsvngkpsatdarlapingkksdgspftvnfgivvsedghdsdyndgivvlqwpi g
Timeline for d2wr9c_: