Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins) barrel, closed; n=8, S=12, meander |
Protein Retinol binding protein [50816] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [50819] (17 PDB entries) |
Domain d2wr6a_: 2wr6 A: [169596] automated match to d1brpa_ complexed with cl, odt |
PDB Entry: 2wr6 (more details), 1.8 Å
SCOPe Domain Sequences for d2wr6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wr6a_ b.60.1.1 (A:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]} erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngyc
Timeline for d2wr6a_: