Lineage for d2wqzd_ (2wqz D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780927Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 1780953Protein Ligand-binding domain of neurexin 1beta [49949] (3 species)
  7. 1780962Species Norway rat (Rattus norvegicus) [TaxId:10116] [49950] (5 PDB entries)
  8. 1780987Domain d2wqzd_: 2wqz D: [169595]
    automatically matched to d1c4rg_
    complexed with 5ax, ca

Details for d2wqzd_

PDB Entry: 2wqz (more details), 3.9 Å

PDB Description: crystal structure of synaptic protein neuroligin-4 in complex with neurexin-beta 1: alternative refinement
PDB Compounds: (D:) Neurexin-1-beta

SCOPe Domain Sequences for d2wqzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqzd_ b.29.1.4 (D:) Ligand-binding domain of neurexin 1beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
hagttyifskgggqitykwppndrpstradrlaigfstvqkeavlvrvdsssglgdylel
hihqgkigvkfnvgtddiaieesnaiindgkyhvvrftrsggnatlqvdswpvierypag
rqltifnsqatiiiggkeqgqpfqgqlsglyynglkvlnmaaendaniaivgnvrlv

SCOPe Domain Coordinates for d2wqzd_:

Click to download the PDB-style file with coordinates for d2wqzd_.
(The format of our PDB-style files is described here.)

Timeline for d2wqzd_: