![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.177: FAH [56528] (1 superfamily) unusual fold; contains 3 layers of beta-sheet structure |
![]() | Superfamily d.177.1: FAH [56529] (2 families) ![]() |
![]() | Family d.177.1.1: FAH [56530] (7 proteins) automatically mapped to Pfam PF01557 |
![]() | Protein automated matches [191123] (4 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189200] (1 PDB entry) |
![]() | Domain d2wqtt_: 2wqt T: [169593] automated match to d1sv6a_ complexed with k, na, po4 |
PDB Entry: 2wqt (more details), 2.8 Å
SCOPe Domain Sequences for d2wqtt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wqtt_ d.177.1.1 (T:) automated matches {Escherichia coli K-12 [TaxId: 83333]} lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav nagdrfeahiegigsvaatfss
Timeline for d2wqtt_: