Lineage for d2wqts_ (2wqt S:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1227766Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 1227767Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 1227768Family d.177.1.1: FAH [56530] (7 proteins)
  6. 1227824Protein automated matches [191123] (2 species)
    not a true protein
  7. 1227825Species Escherichia coli K-12 [TaxId:83333] [189200] (1 PDB entry)
  8. 1227844Domain d2wqts_: 2wqt S: [169592]
    automated match to d1sv6a_
    complexed with k, na, po4

Details for d2wqts_

PDB Entry: 2wqt (more details), 2.8 Å

PDB Description: dodecahedral assembly of mhpd
PDB Compounds: (S:) 2-keto-4-pentenoate hydratase

SCOPe Domain Sequences for d2wqts_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqts_ d.177.1.1 (S:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
nagdrfeahiegigsvaatfss

SCOPe Domain Coordinates for d2wqts_:

Click to download the PDB-style file with coordinates for d2wqts_.
(The format of our PDB-style files is described here.)

Timeline for d2wqts_: