Lineage for d2wqtn_ (2wqt N:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004669Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 3004725Protein automated matches [191123] (4 species)
    not a true protein
  7. 3004726Species Escherichia coli K-12 [TaxId:83333] [189200] (1 PDB entry)
  8. 3004740Domain d2wqtn_: 2wqt N: [169587]
    automated match to d1sv6a_
    complexed with k, na, po4

Details for d2wqtn_

PDB Entry: 2wqt (more details), 2.8 Å

PDB Description: dodecahedral assembly of mhpd
PDB Compounds: (N:) 2-keto-4-pentenoate hydratase

SCOPe Domain Sequences for d2wqtn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqtn_ d.177.1.1 (N:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
nagdrfeahiegigsvaatfss

SCOPe Domain Coordinates for d2wqtn_:

Click to download the PDB-style file with coordinates for d2wqtn_.
(The format of our PDB-style files is described here.)

Timeline for d2wqtn_: