Lineage for d1d1da1 (1d1d A:151-230)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. Protein RSV capsid protein [47361] (1 species)
  7. Species Rous sarcoma virus [TaxId:11886] [47362] (2 PDB entries)
  8. Domain d1d1da1: 1d1d A:151-230 [16958]
    Other proteins in same PDB: d1d1da2

Details for d1d1da1

PDB Entry: 1d1d (more details)

PDB Description: nmr solution structure of the capsid protein from rous sarcoma virus
PDB Compounds: (A:) protein (capsid protein)

SCOPe Domain Sequences for d1d1da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d1da1 a.28.3.1 (A:151-230) RSV capsid protein {Rous sarcoma virus [TaxId: 11886]}
gpwaditqgpsesfvdfanrlikavegsdlppsarapviidcfrqksqpdiqqliraaps
tlttpgeiikyvldrqkiap

SCOPe Domain Coordinates for d1d1da1 are not available.

Timeline for d1d1da1:

Domains from same chain:
(mouse over for more information)
d1d1da2