Lineage for d2wqta_ (2wqt A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3004667Fold d.177: FAH [56528] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure
  4. 3004668Superfamily d.177.1: FAH [56529] (2 families) (S)
  5. 3004669Family d.177.1.1: FAH [56530] (7 proteins)
    automatically mapped to Pfam PF01557
  6. 3004725Protein automated matches [191123] (4 species)
    not a true protein
  7. 3004726Species Escherichia coli K-12 [TaxId:83333] [189200] (1 PDB entry)
  8. 3004727Domain d2wqta_: 2wqt A: [169574]
    automated match to d1sv6a_
    complexed with k, na, po4

Details for d2wqta_

PDB Entry: 2wqt (more details), 2.8 Å

PDB Description: dodecahedral assembly of mhpd
PDB Compounds: (A:) 2-keto-4-pentenoate hydratase

SCOPe Domain Sequences for d2wqta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqta_ d.177.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lmtkhtleqlaadlrraaeqgeaiaplrdligidnaeaayaiqhinvqhdvaqgrrvvgr
kvglthpkvqqqlgvdqpdfgtlfadmcygdneiipfsrvlqprieaeialvlnrdlpat
ditfdelynaiewvlpalevvgsrirdwsiqfvdtvadnascgvyviggpaqrpagldlk
ncamkmtrnneevssgrgseclghplnaavwlarkmaslgeplrtgdiiltgalgpmvav
nagdrfeahiegigsvaatfss

SCOPe Domain Coordinates for d2wqta_:

Click to download the PDB-style file with coordinates for d2wqta_.
(The format of our PDB-style files is described here.)

Timeline for d2wqta_: