Lineage for d2wqoa1 (2wqo A:3-271)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2983276Protein automated matches [190091] (20 species)
    not a true protein
  7. 2983389Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries)
  8. 2983742Domain d2wqoa1: 2wqo A:3-271 [169573]
    Other proteins in same PDB: d2wqoa2
    automated match to d2java1
    complexed with cl, vgk

Details for d2wqoa1

PDB Entry: 2wqo (more details), 2.17 Å

PDB Description: structure of nek2 bound to the aminopyridine cct241950
PDB Compounds: (A:) serine/threonine-protein kinase nek2

SCOPe Domain Sequences for d2wqoa1:

Sequence, based on SEQRES records: (download)

>d2wqoa1 d.144.1.7 (A:3-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sraedyevlytigtgsygrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrel
khpnivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltl
alkechrrsdgghtvlhrdlkpanvfldgkqnvklgdfglarilnhdtsfaktfvgtpyy
mspeqmnrmsyneksdiwslgcllyelcalmppftafsqkelagkiregkfrripyrysd
elneiitrmlnlkdyhrpsveeilenpli

Sequence, based on observed residues (ATOM records): (download)

>d2wqoa1 d.144.1.7 (A:3-271) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sraedyevlytigtgrcqkirrksdgkilvwkeldygsmteaekqmlvsevnllrelkhp
nivryydriidrtnttlyivmeyceggdlasvitkgtkerqyldeefvlrvmtqltlalk
echrrlkpanvfldgkqnvklgdgtpyymspeqmnrneksdiwslgcllyelcalmppft
afsqkelagkiregkfrripyrysdelneiitrmlnlkdyhrpsveeilenpli

SCOPe Domain Coordinates for d2wqoa1:

Click to download the PDB-style file with coordinates for d2wqoa1.
(The format of our PDB-style files is described here.)

Timeline for d2wqoa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wqoa2