Lineage for d2wqld_ (2wql D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1926121Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1926373Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1926374Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 1926437Protein automated matches [190058] (5 species)
    not a true protein
  7. 1926442Species Carrot (Daucus carota) [TaxId:4039] [189035] (1 PDB entry)
  8. 1926446Domain d2wqld_: 2wql D: [169572]
    automated match to d2bk0a1
    complexed with cl, p4c, peg

Details for d2wqld_

PDB Entry: 2wql (more details), 2.7 Å

PDB Description: crystal structure of the major carrot allergen dau c 1
PDB Compounds: (D:) major allergen dau c 1

SCOPe Domain Sequences for d2wqld_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqld_ d.129.3.1 (D:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
kgdavvpeenikfadaqntalfkaieaylian

SCOPe Domain Coordinates for d2wqld_:

Click to download the PDB-style file with coordinates for d2wqld_.
(The format of our PDB-style files is described here.)

Timeline for d2wqld_: