Lineage for d2wqlc_ (2wql C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975505Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (5 proteins)
  6. 2975569Protein automated matches [190058] (11 species)
    not a true protein
  7. 2975577Species Carrot (Daucus carota) [TaxId:4039] [189035] (1 PDB entry)
  8. 2975580Domain d2wqlc_: 2wql C: [169571]
    automated match to d2bk0a1
    complexed with cl, p4c, peg

Details for d2wqlc_

PDB Entry: 2wql (more details), 2.7 Å

PDB Description: crystal structure of the major carrot allergen dau c 1
PDB Compounds: (C:) major allergen dau c 1

SCOPe Domain Sequences for d2wqlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqlc_ d.129.3.1 (C:) automated matches {Carrot (Daucus carota) [TaxId: 4039]}
aqshsleitssvsaekifsgivldvdtvipkaatgayksvevkgdggagtvriitlpegs
pittmtvrtdavnkealsydstvidgdillgfiesiethmvvvptadggsitkttaifht
kgdavvpeenikfadaqntalfkaieaylian

SCOPe Domain Coordinates for d2wqlc_:

Click to download the PDB-style file with coordinates for d2wqlc_.
(The format of our PDB-style files is described here.)

Timeline for d2wqlc_: