Lineage for d2wqaf_ (2wqa F:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2071989Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2071990Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2071991Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2072408Protein Retinol binding protein [50816] (5 species)
  7. 2072426Species Human (Homo sapiens) [TaxId:9606] [50819] (9 PDB entries)
  8. 2072435Domain d2wqaf_: 2wqa F: [169563]
    Other proteins in same PDB: d2wqaa_, d2wqab_, d2wqac_, d2wqad_
    automated match to d1brpa_
    complexed with ola, so4

Details for d2wqaf_

PDB Entry: 2wqa (more details), 2.85 Å

PDB Description: complex of ttr and rbp4 and oleic acid
PDB Compounds: (F:) retinol-binding protein 4

SCOPe Domain Sequences for d2wqaf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wqaf_ b.60.1.1 (F:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngycdg

SCOPe Domain Coordinates for d2wqaf_:

Click to download the PDB-style file with coordinates for d2wqaf_.
(The format of our PDB-style files is described here.)

Timeline for d2wqaf_: