Lineage for d2wqab_ (2wqa B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939304Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 939305Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
  6. 939306Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 939327Species Human (Homo sapiens) [TaxId:9606] [49475] (141 PDB entries)
    Uniprot P02766 31-143
  8. 939631Domain d2wqab_: 2wqa B: [169559]
    Other proteins in same PDB: d2wqae_, d2wqaf_
    automated match to d1eta1_
    complexed with ola, so4

Details for d2wqab_

PDB Entry: 2wqa (more details), 2.85 Å

PDB Description: complex of ttr and rbp4 and oleic acid
PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d2wqab_:

Sequence, based on SEQRES records: (download)

>d2wqab_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtn

Sequence, based on observed residues (ATOM records): (download)

>d2wqab_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
gkcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefveg
iykveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

SCOPe Domain Coordinates for d2wqab_:

Click to download the PDB-style file with coordinates for d2wqab_.
(The format of our PDB-style files is described here.)

Timeline for d2wqab_: