Lineage for d2wq9a_ (2wq9 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1799770Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1799771Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1799772Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1800157Protein Retinol binding protein [50816] (5 species)
  7. 1800175Species Human (Homo sapiens) [TaxId:9606] [50819] (9 PDB entries)
  8. 1800176Domain d2wq9a_: 2wq9 A: [169557]
    automated match to d1brpa_
    complexed with cl, gol, ola

Details for d2wq9a_

PDB Entry: 2wq9 (more details), 1.65 Å

PDB Description: crystal structure of rbp4 bound to oleic acid
PDB Compounds: (A:) retinol-binding protein 4

SCOPe Domain Sequences for d2wq9a_:

Sequence, based on SEQRES records: (download)

>d2wq9a_ b.60.1.1 (A:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqysc
rllnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngyc

Sequence, based on observed residues (ATOM records): (download)

>d2wq9a_ b.60.1.1 (A:) Retinol binding protein {Human (Homo sapiens) [TaxId: 9606]}
erdcrvssfrvkenfdkarfsgtwyamakkdpeglflqdnivaefsvdetgqmsatakgr
vrllnwdvcadmvgtftdtedpakfkmkywgvasflqkgnddhwivdtdydtyavqyscr
llnldgtcadsysfvfsrdpnglppeaqkivrqrqeelclarqyrlivhngyc

SCOPe Domain Coordinates for d2wq9a_:

Click to download the PDB-style file with coordinates for d2wq9a_.
(The format of our PDB-style files is described here.)

Timeline for d2wq9a_: