Lineage for d2wq5a_ (2wq5 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733440Species Indian cobra (Naja naja) [TaxId:35670] [189291] (2 PDB entries)
  8. 2733442Domain d2wq5a_: 2wq5 A: [169556]
    automated match to d1a3da_
    complexed with ca, miy, so4

Details for d2wq5a_

PDB Entry: 2wq5 (more details), 1.65 Å

PDB Description: non-antibiotic properties of tetracyclines: structural basis for inhibition of secretory phospholipase a2.
PDB Compounds: (A:) phospholipase a2, acidic

SCOPe Domain Sequences for d2wq5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wq5a_ a.133.1.2 (A:) automated matches {Indian cobra (Naja naja) [TaxId: 35670]}
nlyqfknmikctvpsrswwdfadygcycgrggsgtpvddldrccqvhdncyneaekiskc
wpffktysykcsqgtltckggnnacaasvcdcdrlaaicfagapyndnnynidlkarcq

SCOPe Domain Coordinates for d2wq5a_:

Click to download the PDB-style file with coordinates for d2wq5a_.
(The format of our PDB-style files is described here.)

Timeline for d2wq5a_: