SCOPe 2.08: Domain d2wptb_: 2wpt B:

Lineage for d2wptb_ (2wpt B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.4: His-Me finger endonucleases [54059] (1 superfamily)
   core: (alpha)-beta-omega_loop-beta-alpha; embeded in larger different structures

4. Superfamily d.4.1: His-Me finger endonucleases [54060] (8 families)
   common motif contains conserved histidine residue and metal-binding site

5. Family d.4.1.1: HNH-motif [54061] (3 proteins)

6. Protein automated matches [190311] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187878] (9 PDB entries)

8. Domain d2wptb_: 2wpt B: [169555]
   Other proteins in same PDB: d2wpta_
   automated match to d1fsjb_
   protein/DNA complex; complexed with gol, no3

Details for d2wptb_

PDB Entry: 2wpt, 1.78 Å

PDB Description: the crystal structure of im2 in complex with colicin e9 dnase

PDB Compounds: (B:) colicin-e9

SCOPe Domain Sequences for d2wptb_:

Sequence, based on SEQRES records:

>d2wptb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevskdpel
sknlnpsnkssvskgyspftpknqqvgcrkvyelhhdkpisqggevydmdnirvttpk

Sequence, based on observed residues (ATOM records):

>d2wptb_ d.4.1.1 (B:) automated matches {Escherichia coli [TaxId: 562]}
pgkatgkgkpvgdkwlddagkdsgapipdriadklrdkefksfddfrkavweevskdpel
sknlnpsnkssvskgyspftpknqqvgcrkvyelhhdkgevydmdnirvttpk

Timeline for d2wptb_:

• d2wptb_ first appeared in SCOPe 2.01
  
• d2wptb_ appears in SCOPe 2.07