Lineage for d2wpta_ (2wpt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706394Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 2706395Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 2706445Protein automated matches [190365] (1 species)
    not a true protein
  7. 2706446Species Escherichia coli [TaxId:562] [187200] (5 PDB entries)
  8. 2706449Domain d2wpta_: 2wpt A: [169554]
    Other proteins in same PDB: d2wptb_
    automated match to d1e0ha_
    protein/DNA complex; complexed with gol, no3

Details for d2wpta_

PDB Entry: 2wpt (more details), 1.78 Å

PDB Description: the crystal structure of im2 in complex with colicin e9 dnase
PDB Compounds: (A:) colicin-e2 immunity protein

SCOPe Domain Sequences for d2wpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpta_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
khsisdyteaeflefvkkiaraegatecddnklvreferltehpdgsdliyyprddreds
pegivkeikewraangksgfkq

SCOPe Domain Coordinates for d2wpta_:

Click to download the PDB-style file with coordinates for d2wpta_.
(The format of our PDB-style files is described here.)

Timeline for d2wpta_: