SCOPe 2.02: Domain d2wpms_: 2wpm S:

Lineage for d2wpms_ (2wpm S:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (122 PDB entries)

8. Domain d2wpms_: 2wpm S: [169552]
   Other proteins in same PDB: d2wpme_
   automated match to d1rfna_
   complexed with ca; mutant

Details for d2wpms_

PDB Entry: 2wpm, 2 Å

PDB Description: factor ixa superactive mutant, egr-cmk inhibited

PDB Compounds: (S:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d2wpms_:

Sequence; same for both SEQRES and ATOM records:

>d2wpms_ b.47.1.2 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgraalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

Timeline for d2wpms_:

• d2wpms_ first appeared in SCOPe 2.01
  
• d2wpms_ appears in SCOPe 2.03
  
• d2wpms_ appears in the current release, SCOPe 2.08