Class g: Small proteins [56992] (98 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.1: EGF-type module [57197] (23 proteins) |
Protein automated matches [190092] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187310] (72 PDB entries) |
Domain d2wpme_: 2wpm E: [169551] Other proteins in same PDB: d2wpms_ automated match to d1rfnb_ complexed with ca; mutant |
PDB Entry: 2wpm (more details), 2 Å
SCOPe Domain Sequences for d2wpme_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wpme_ g.3.11.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr
Timeline for d2wpme_: