Lineage for d2wpme_ (2wpm E:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3029893Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 3031137Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 3031138Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 3031664Protein automated matches [190092] (2 species)
    not a true protein
  7. 3031665Species Human (Homo sapiens) [TaxId:9606] [187310] (69 PDB entries)
  8. 3031719Domain d2wpme_: 2wpm E: [169551]
    Other proteins in same PDB: d2wpms_
    automated match to d1rfnb_
    complexed with ca; mutant

Details for d2wpme_

PDB Entry: 2wpm (more details), 2 Å

PDB Description: factor ixa superactive mutant, egr-cmk inhibited
PDB Compounds: (E:) Coagulation factor IXa light chain

SCOPe Domain Sequences for d2wpme_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpme_ g.3.11.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr

SCOPe Domain Coordinates for d2wpme_:

Click to download the PDB-style file with coordinates for d2wpme_.
(The format of our PDB-style files is described here.)

Timeline for d2wpme_: