SCOPe 2.07: Domain d2wpls_: 2wpl S:

Lineage for d2wpls_ (2wpl S:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)

8. Domain d2wpls_: 2wpl S: [169550]
   Other proteins in same PDB: d2wple_
   automated match to d1rfna_
   mutant

Details for d2wpls_

PDB Entry: 2wpl, 1.82 Å

PDB Description: factor ixa superactive triple mutant, edta-soaked

PDB Compounds: (S:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d2wpls_:

Sequence; same for both SEQRES and ATOM records:

>d2wpls_ b.47.1.2 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

Timeline for d2wpls_:

• d2wpls_ first appeared in SCOPe 2.01
  
• d2wpls_ appears in SCOPe 2.06
  
• d2wpls_ appears in the current release, SCOPe 2.08