Lineage for d2wpls_ (2wpl S:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 953177Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 954551Protein automated matches [190044] (7 species)
    not a true protein
  7. 954573Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries)
  8. 954629Domain d2wpls_: 2wpl S: [169550]
    Other proteins in same PDB: d2wple_
    automated match to d1rfna_
    mutant

Details for d2wpls_

PDB Entry: 2wpl (more details), 1.82 Å

PDB Description: factor ixa superactive triple mutant, edta-soaked
PDB Compounds: (S:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d2wpls_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wpls_ b.47.1.2 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

SCOPe Domain Coordinates for d2wpls_:

Click to download the PDB-style file with coordinates for d2wpls_.
(The format of our PDB-style files is described here.)

Timeline for d2wpls_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wple_