SCOPe 2.01: Domain d2wpks_: 2wpk S:

Lineage for d2wpks_ (2wpk S:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein automated matches [190044] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries)

8. Domain d2wpks_: 2wpk S: [169548]
   Other proteins in same PDB: d2wpke_
   automated match to d1rfna_
   complexed with ca, edo; mutant

Details for d2wpks_

PDB Entry: 2wpk, 2.21 Å

PDB Description: factor ixa superactive triple mutant, ethylene glycol-soaked

PDB Compounds: (S:) Coagulation factor IXa heavy chain

SCOPe Domain Sequences for d2wpks_:

Sequence; same for both SEQRES and ATOM records:

>d2wpks_ b.47.1.2 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vvggedakpgqfpwqvvlngkvdafcggsivnekwivtaahcvetgvkitvvagehniee
tehteqkrnviriiphhnfnaaintynhdialleldeplvlnsyvtpiciadkeytnifl
kfgsgyvsgwgrvfhkgrsalvlqylrvplvdratclrstkftitnnmfcagfheggrds
cqgdsggphvtevegtsfltgiiswgeecamkgkygiytkvsryvnwikektklt

Timeline for d2wpks_:

• d2wpks_ is new in SCOPe 2.01-stable
  
• d2wpks_ appears in SCOPe 2.02
  
• d2wpks_ appears in the current release, SCOPe 2.08