SCOPe 2.01: Domain d2wpke_: 2wpk E:

Lineage for d2wpke_ (2wpk E:)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (7 families)

5. Family g.3.11.1: EGF-type module [57197] (23 proteins)

6. Protein automated matches [190092] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187310] (52 PDB entries)

8. Domain d2wpke_: 2wpk E: [169547]
   Other proteins in same PDB: d2wpks_
   automated match to d1rfnb_
   complexed with ca, edo; mutant

Details for d2wpke_

PDB Entry: 2wpk, 2.21 Å

PDB Description: factor ixa superactive triple mutant, ethylene glycol-soaked

PDB Compounds: (E:) Coagulation factor IXa light chain

SCOPe Domain Sequences for d2wpke_:

Sequence; same for both SEQRES and ATOM records:

>d2wpke_ g.3.11.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tcnikngrceqfcknsadnkvvcsctegyrlaenqkscepavpfpcgrvsvsqtskltr

Timeline for d2wpke_:

• d2wpke_ is new in SCOPe 2.01-stable
  
• d2wpke_ appears in SCOPe 2.02
  
• d2wpke_ appears in the current release, SCOPe 2.08