![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
![]() | Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families) ![]() |
![]() | Family d.41.5.0: automated matches [191646] (1 protein) not a true family |
![]() | Protein automated matches [191185] (6 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [189459] (2 PDB entries) |
![]() | Domain d2wp4b_: 2wp4 B: [169535] automated match to d1fm0e_ complexed with ca, gol |
PDB Entry: 2wp4 (more details), 2.49 Å
SCOPe Domain Sequences for d2wp4b_:
Sequence, based on SEQRES records: (download)
>d2wp4b_ d.41.5.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} anvvaegaypycrltdqplsvdevlaavsgpeqggivifvgnvrdhnaghdvtrlfyeay ppmvirtlmsiigrcedkaegvrvavahrtgelqigdaavvigasaphraeafdaarmci ellkqevpiwkkefs
>d2wp4b_ d.41.5.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} anvvaegaypycrltdqplsvdevlaavsgpeqggivifvgnvrdhndvtrlfyeayppm virtlmsiigrcedkaegvrvavahrtgelqigdaavvigasaphraeafdaarmciell kqevpiwkkefs
Timeline for d2wp4b_: