SCOPe 2.01: Domain d2wp4a_: 2wp4 A:

Lineage for d2wp4a_ (2wp4 A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.5: Molybdopterin synthase subunit MoaE [54690] (2 families)

5. Family d.41.5.0: automated matches [191646] (1 protein)
   not a true family

6. Protein automated matches [191185] (1 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189459] (1 PDB entry)

8. Domain d2wp4a_: 2wp4 A: [169534]
   automated match to d1fm0e_
   complexed with ca, gol

Details for d2wp4a_

PDB Entry: 2wp4, 2.49 Å

PDB Description: crystal structure of rv3119 from mycobacterium tuberculosis

PDB Compounds: (A:) molybdopterin-converting factor subunit 2 1

SCOPe Domain Sequences for d2wp4a_:

Sequence, based on SEQRES records:

>d2wp4a_ d.41.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ypycrltdqplsvdevlaavsgpeqggivifvgnvrdhnaghdvtrlfyeayppmvirtl
msiigrcedkaegvrvavahrtgelqigdaavvigasaphraeafdaarmciellkqevp
iwkkefss

Sequence, based on observed residues (ATOM records):

>d2wp4a_ d.41.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
ypycrltdqplsvdevlaavsgpeqggivifvgnvrdtrlfyeayppmvirtlmsiigrc
edkaegvrvavahrtgelqigdaavvigasaphraeafdaarmciellkqevpiwkkefs
s

Timeline for d2wp4a_:

• d2wp4a_ is new in SCOPe 2.01-stable
  
• d2wp4a_ appears in SCOPe 2.02
  
• d2wp4a_ appears in the current release, SCOPe 2.08