SCOPe 2.08: Domain d2wota1: 2wot A:200-500

Lineage for d2wota1 (2wot A:200-500)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Type I TGF-beta receptor R4 [56144] (1 species)
   TKL group; STKR subfamily; serine/threonine kinase; possible evolutionary link to tyrosine kinases

7. Species Human (Homo sapiens) [TaxId:9606] [56145] (32 PDB entries)
   Uniprot P36897 200-500 ! Uniprot P36897 201-503

8. Domain d2wota1: 2wot A:200-500 [169532]
   Other proteins in same PDB: d2wota2
   automated match to d1vjya_
   complexed with edo, zzg

Details for d2wota1

PDB Entry: 2wot, 1.85 Å

PDB Description: alk5 in complex with 4-((5,6-dimethyl-2-(2-pyridyl)-3-pyridyl)oxy)-n- (3,4,5-trimethoxyphenyl)pyridin-2-amine

PDB Compounds: (A:) TGF-beta receptor type-1

SCOPe Domain Sequences for d2wota1:

Sequence; same for both SEQRES and ATOM records:

>d2wota1 d.144.1.7 (A:200-500) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]}
tiartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrheni
lgfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhme
ivgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkrym
apevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsve
emrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqe
g

Timeline for d2wota1:

• d2wota1 first appeared in SCOPe 2.01, called d2wota_
  
• d2wota1 appears in SCOPe 2.07